PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_87924B626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 269aa    MW: 28860.7 Da    PI: 8.314
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_87924B626.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l+  +k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_5BL_87924B626.1 14 KGAWTKEEDQRLIAHIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                           79******************************99************97 PP

2Myb_DNA-binding582.1e-1867111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++T eEdel++++++ lG++ W++Ia +++ gRt++++k++w+++
  Traes_5BL_87924B626.1  67 RGNFTDEEDELIIKLHEFLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.536961IPR017930Myb domain
SuperFamilySSF466892.88E-2913108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
CDDcd001671.33E-111661No hitNo description
PROSITE profilePS5129427.52862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2865116IPR009057Homeodomain-like
SMARTSM007171.6E-1766114IPR001005SANT/Myb domain
PfamPF002492.6E-1667111IPR001005SANT/Myb domain
CDDcd001677.72E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDELIIK LHEFLGNKWS LIAGRLPGRT DNEIKNYWNT HVKRKLLARG  120
VDPQTHRPLN AGTAAVQGIH TPSSPAVASG ASPHQLAGGS SCSPDASGHS SDADDSVSLP  180
PSLAGNLGVG MIDLNLSICP PCQPPLSREA DGVLRTGYSE REKICLCLNR LGLHGGEGCS  240
CVGSSSSSSL HPASSGVLRF LDASLFRDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2261400.0KF226140.1 Triticum aestivum cultivar RNIL_Sumai3 R2R3-Myb transcription factor (MybFhb5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615594.11e-104PREDICTED: myb-related protein 308
SwissprotP813936e-95MYB08_ANTMA; Myb-related protein 308
TrEMBLW5FEB40.0W5FEB4_WHEAT; Uncharacterized protein
STRINGMLOC_63914.11e-150(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-87myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]